Lineage for d1vqka2 (1vqk A:1-90)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668307Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
    barrel, closed; n=5, S=8
  6. 668391Protein N-terminal domain of ribosomal protein L2 [50299] (2 species)
    incomplete OB-fold lacking the last strand
  7. 668392Species Archaeon Haloarcula marismortui [TaxId:2238] [50301] (40 PDB entries)
    includes the N-terminal tail
  8. 668398Domain d1vqka2: 1vqk A:1-90 [120246]
    Other proteins in same PDB: d1vqk11, d1vqk31, d1vqka1, d1vqkb1, d1vqkc1, d1vqkd1, d1vqke1, d1vqke2, d1vqkf1, d1vqkh1, d1vqki1, d1vqkj1, d1vqkk1, d1vqkl1, d1vqkm1, d1vqkn1, d1vqko1, d1vqkp1, d1vqkq1, d1vqkr1, d1vqks1, d1vqkt1, d1vqku1, d1vqkv1, d1vqkw1, d1vqkx1, d1vqky1, d1vqkz1
    automatically matched to d1s72a2
    complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sr, ur3

Details for d1vqka2

PDB Entry: 1vqk (more details), 2.3 Å

PDB Description: the structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
PDB Compounds: (A:) 50S ribosomal protein L2P

SCOP Domain Sequences for d1vqka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqka2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui [TaxId: 2238]}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvsaeiap

SCOP Domain Coordinates for d1vqka2:

Click to download the PDB-style file with coordinates for d1vqka2.
(The format of our PDB-style files is described here.)

Timeline for d1vqka2: