Lineage for d1vqk31 (1vqk 3:1-92)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 751110Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families) (S)
  5. 751197Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
  6. 751198Protein Ribosomal protein L44e [57837] (1 species)
  7. 751199Species Archaeon Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries)
  8. 751205Domain d1vqk31: 1vqk 3:1-92 [120244]
    Other proteins in same PDB: d1vqk11, d1vqka1, d1vqka2, d1vqkb1, d1vqkc1, d1vqkd1, d1vqke1, d1vqke2, d1vqkf1, d1vqkh1, d1vqki1, d1vqkj1, d1vqkk1, d1vqkl1, d1vqkm1, d1vqkn1, d1vqko1, d1vqkp1, d1vqkq1, d1vqkr1, d1vqks1, d1vqkt1, d1vqku1, d1vqkv1, d1vqkw1, d1vqkx1, d1vqky1, d1vqkz1
    automatically matched to d1ffkz_
    complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sr, ur3

Details for d1vqk31

PDB Entry: 1vqk (more details), 2.3 Å

PDB Description: the structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
PDB Compounds: (3:) 50S ribosomal protein L44E

SCOP Domain Sequences for d1vqk31:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqk31 g.41.8.3 (3:1-92) Ribosomal protein L44e {Archaeon Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOP Domain Coordinates for d1vqk31:

Click to download the PDB-style file with coordinates for d1vqk31.
(The format of our PDB-style files is described here.)

Timeline for d1vqk31: