Class g: Small proteins [56992] (85 folds) |
Fold g.41: Rubredoxin-like [57769] (16 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families) |
Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein) |
Protein Ribosomal protein L44e [57837] (1 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries) |
Domain d1vqk31: 1vqk 3:1-92 [120244] Other proteins in same PDB: d1vqk11, d1vqka1, d1vqka2, d1vqkb1, d1vqkc1, d1vqkd1, d1vqke1, d1vqke2, d1vqkf1, d1vqkh1, d1vqki1, d1vqkj1, d1vqkk1, d1vqkl1, d1vqkm1, d1vqkn1, d1vqko1, d1vqkp1, d1vqkq1, d1vqkr1, d1vqks1, d1vqkt1, d1vqku1, d1vqkv1, d1vqkw1, d1vqkx1, d1vqky1, d1vqkz1 automatically matched to d1ffkz_ complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sr, ur3 |
PDB Entry: 1vqk (more details), 2.3 Å
SCOP Domain Sequences for d1vqk31:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqk31 g.41.8.3 (3:1-92) Ribosomal protein L44e {Archaeon Haloarcula marismortui [TaxId: 2238]} mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk ptkktdlkyrcgecgkahlregwragrlefqe
Timeline for d1vqk31:
View in 3D Domains from other chains: (mouse over for more information) d1vqk11, d1vqka1, d1vqka2, d1vqkb1, d1vqkc1, d1vqkd1, d1vqke1, d1vqke2, d1vqkf1, d1vqkh1, d1vqki1, d1vqkj1, d1vqkk1, d1vqkl1, d1vqkm1, d1vqkn1, d1vqko1, d1vqkp1, d1vqkq1, d1vqkr1, d1vqks1, d1vqkt1, d1vqku1, d1vqkv1, d1vqkw1, d1vqkx1, d1vqky1, d1vqkz1 |