SCOP 1.73: Domain d1vqkw1: 1vqk W:1-154

Lineage for d1vqkw1 (1vqk W:1-154)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
   core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold

4. Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family)

5. Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)

6. Protein Archaeal L30 (L30a) [55133] (1 species)
   long-chain member of the family; contains additional C-terminal (sub)domain

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries)

8. Domain d1vqkw1: 1vqk W:1-154 [120268]
   Other proteins in same PDB: d1vqk11, d1vqk31, d1vqka1, d1vqka2, d1vqkb1, d1vqkc1, d1vqkd1, d1vqke1, d1vqke2, d1vqkf1, d1vqkh1, d1vqki1, d1vqkj1, d1vqkk1, d1vqkl1, d1vqkm1, d1vqkn1, d1vqko1, d1vqkp1, d1vqkq1, d1vqkr1, d1vqks1, d1vqkt1, d1vqku1, d1vqkv1, d1vqkx1, d1vqky1, d1vqkz1
   automatically matched to d1ffkt_
   complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sr, ur3

Details for d1vqkw1

PDB Entry: 1vqk, 2.3 Å

PDB Description: the structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui

PDB Compounds: (W:) 50S ribosomal protein L30P

SCOP Domain Sequences for d1vqkw1:

Sequence; same for both SEQRES and ATOM records:

>d1vqkw1 d.59.1.1 (W:1-154) Archaeal L30 (L30a) {Archaeon Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

Timeline for d1vqkw1:

• d1vqkw1 is new in SCOP 1.73
  
• d1vqkw1 appears in SCOP 1.75
  
• d1vqkw1 appears in the current release, SCOPe 2.08