SCOP 1.73: Domain d1vqks1: 1vqk S:1-81

Lineage for d1vqks1 (1vqk S:1-81)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.1: L23p [54190] (1 protein)

6. Protein Ribosomal protein L23 [54191] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54192] (44 PDB entries)

8. Domain d1vqks1: 1vqk S:1-81 [120264]
   Other proteins in same PDB: d1vqk11, d1vqk31, d1vqka1, d1vqka2, d1vqkb1, d1vqkc1, d1vqkd1, d1vqke1, d1vqke2, d1vqkf1, d1vqkh1, d1vqki1, d1vqkj1, d1vqkk1, d1vqkl1, d1vqkm1, d1vqkn1, d1vqko1, d1vqkp1, d1vqkq1, d1vqkr1, d1vqkt1, d1vqku1, d1vqkv1, d1vqkw1, d1vqkx1, d1vqky1, d1vqkz1
   automatically matched to d1jj2r_
   complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sr, ur3

Details for d1vqks1

PDB Entry: 1vqk, 2.3 Å

PDB Description: the structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui

PDB Compounds: (S:) 50S ribosomal protein L23P

SCOP Domain Sequences for d1vqks1:

Sequence; same for both SEQRES and ATOM records:

>d1vqks1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Archaeon Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

Timeline for d1vqks1:

• d1vqks1 is new in SCOP 1.73
  
• d1vqks1 appears in SCOP 1.75
  
• d1vqks1 appears in the current release, SCOPe 2.08