![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) ![]() |
![]() | Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins) automatically mapped to Pfam PF01220 |
![]() | Protein automated matches [190071] (6 species) not a true protein |
![]() | Species Streptomyces coelicolor [TaxId:1902] [186791] (3 PDB entries) |
![]() | Domain d1v1jf_: 1v1j F: [119823] automated match to d1d0ia_ complexed with fa3, trs |
PDB Entry: 1v1j (more details), 2.2 Å
SCOPe Domain Sequences for d1v1jf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v1jf_ c.23.13.1 (F:) automated matches {Streptomyces coelicolor [TaxId: 1902]} prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs yvsqradgvvagcgvqgyvfgveriaalag
Timeline for d1v1jf_: