Lineage for d1d0ia_ (1d0i A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. Protein Type II 3-dehydroquinate dehydratase [52306] (6 species)
  7. Species Streptomyces coelicolor [TaxId:1902] [52308] (4 PDB entries)
  8. Domain d1d0ia_: 1d0i A: [31383]
    complexed with po4, trs

Details for d1d0ia_

PDB Entry: 1d0i (more details), 1.8 Å

PDB Description: crystal structure of type ii dehydroquinase from streptomyces coelicolor complexed with phosphate ions
PDB Compounds: (A:) type II 3-dehydroquinate hydratase

SCOPe Domain Sequences for d1d0ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0ia_ c.23.13.1 (A:) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor [TaxId: 1902]}
prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
yvsqradgvvagcgvqgyvfgveriaalag

SCOPe Domain Coordinates for d1d0ia_ are not available.

Timeline for d1d0ia_:

Domains from other chains:
(mouse over for more information)
d1d0ib_, d1d0ic_, d1d0id_, d1d0ie_, d1d0if_, d1d0ig_, d1d0ih_, d1d0ii_, d1d0ij_, d1d0ik_, d1d0il_