PDB entry 1d0i

View 1d0i on RCSB PDB site
Description: crystal structure of type II dehydroquinase from streptomyces coelicolor complexed with phosphate ions
Class: lyase
Keywords: type II dehydroquinase, shikimate pathway, dodecameric quaternary structure, tetrahedral symmetry, lyase
Deposited on 1999-09-10, released 2000-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: type II 3-dehydroquinate hydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d0ia_
  • Chain 'B':
    Compound: type II 3-dehydroquinate hydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d0ib_
  • Chain 'C':
    Compound: type II 3-dehydroquinate hydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d0ic_
  • Chain 'D':
    Compound: type II 3-dehydroquinate hydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d0id_
  • Chain 'E':
    Compound: type II 3-dehydroquinate hydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d0ie_
  • Chain 'F':
    Compound: type II 3-dehydroquinate hydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d0if_
  • Chain 'G':
    Compound: type II 3-dehydroquinate hydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d0ig_
  • Chain 'H':
    Compound: type II 3-dehydroquinate hydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d0ih_
  • Chain 'I':
    Compound: type II 3-dehydroquinate hydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d0ii_
  • Chain 'J':
    Compound: type II 3-dehydroquinate hydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d0ij_
  • Chain 'K':
    Compound: type II 3-dehydroquinate hydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d0ik_
  • Chain 'L':
    Compound: type II 3-dehydroquinate hydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d0il_
  • Heterogens: PO4, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d0iA (A:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0iA (A:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d0iB (B:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0iB (B:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1d0iC (C:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0iC (C:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1d0iD (D:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0iD (D:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalaga
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1d0iE (E:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0iE (E:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalagag
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1d0iF (F:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0iF (F:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalaga
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1d0iG (G:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0iG (G:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalaga
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1d0iH (H:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0iH (H:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalagags
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1d0iI (I:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0iI (I:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1d0iJ (J:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0iJ (J:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1d0iK (K:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0iK (K:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalaga
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1d0iL (L:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0iL (L:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalaga