Lineage for d1d0ig_ (1d0i G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857821Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2857822Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 2857823Protein Type II 3-dehydroquinate dehydratase [52306] (6 species)
  7. 2857887Species Streptomyces coelicolor [TaxId:1902] [52308] (4 PDB entries)
  8. 2857918Domain d1d0ig_: 1d0i G: [31389]
    complexed with po4, trs

Details for d1d0ig_

PDB Entry: 1d0i (more details), 1.8 Å

PDB Description: crystal structure of type ii dehydroquinase from streptomyces coelicolor complexed with phosphate ions
PDB Compounds: (G:) type II 3-dehydroquinate hydratase

SCOPe Domain Sequences for d1d0ig_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0ig_ c.23.13.1 (G:) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor [TaxId: 1902]}
prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
yvsqradgvvagcgvqgyvfgveriaalaga

SCOPe Domain Coordinates for d1d0ig_:

Click to download the PDB-style file with coordinates for d1d0ig_.
(The format of our PDB-style files is described here.)

Timeline for d1d0ig_: