Lineage for d1v1jd_ (1v1j D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857821Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2857822Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 2857936Protein automated matches [190071] (6 species)
    not a true protein
  7. 2858239Species Streptomyces coelicolor [TaxId:1902] [186791] (3 PDB entries)
  8. 2858267Domain d1v1jd_: 1v1j D: [119821]
    automated match to d1d0ia_
    complexed with fa3, trs

Details for d1v1jd_

PDB Entry: 1v1j (more details), 2.2 Å

PDB Description: crystal structure of type ii dehydroquintae dehydratase from streptomyces coelicolor in complex with 3-fluoro
PDB Compounds: (D:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d1v1jd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v1jd_ c.23.13.1 (D:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
yvsqradgvvagcgvqgyvfgveriaalag

SCOPe Domain Coordinates for d1v1jd_:

Click to download the PDB-style file with coordinates for d1v1jd_.
(The format of our PDB-style files is described here.)

Timeline for d1v1jd_: