PDB entry 1v1j

View 1v1j on RCSB PDB site
Description: Crystal structure of type II Dehydroquintae Dehydratase from Streptomyces coelicolor in complex with 3-fluoro
Class: lyase
Keywords: dhq, shikimate, dehydroquinase, aromatic amino acid biosynthesis, lyase
Deposited on 2004-04-16, released 2005-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V1J
    • Uniprot P15474 (1-End)
    Domains in SCOPe 2.07: d1v1ja_
  • Chain 'B':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V1J
    • Uniprot P15474 (1-End)
    Domains in SCOPe 2.07: d1v1jb_
  • Chain 'C':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V1J
    • Uniprot P15474 (1-End)
    Domains in SCOPe 2.07: d1v1jc_
  • Chain 'D':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V1J
    • Uniprot P15474 (1-End)
    Domains in SCOPe 2.07: d1v1jd_
  • Chain 'E':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V1J
    • Uniprot P15474 (1-End)
    Domains in SCOPe 2.07: d1v1je_
  • Chain 'F':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V1J
    • Uniprot P15474 (1-End)
    Domains in SCOPe 2.07: d1v1jf_
  • Chain 'G':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V1J
    • Uniprot P15474 (1-End)
    Domains in SCOPe 2.07: d1v1jg_
  • Chain 'H':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V1J
    • Uniprot P15474 (1-End)
    Domains in SCOPe 2.07: d1v1jh_
  • Chain 'I':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V1J
    • Uniprot P15474 (1-End)
    Domains in SCOPe 2.07: d1v1ji_
  • Chain 'J':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V1J
    • Uniprot P15474 (1-End)
    Domains in SCOPe 2.07: d1v1jj_
  • Chain 'K':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V1J
    • Uniprot P15474 (1-End)
    Domains in SCOPe 2.07: d1v1jk_
  • Chain 'L':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V1J
    • Uniprot P15474 (1-End)
    Domains in SCOPe 2.07: d1v1jl_
  • Heterogens: FA3, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v1jA (A:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1jA (A:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v1jB (B:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1jB (B:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v1jC (C:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1jC (C:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1v1jD (D:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1jD (D:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1v1jE (E:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1jE (E:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1v1jF (F:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1jF (F:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1v1jG (G:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1jG (G:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1v1jH (H:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1jH (H:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1v1jI (I:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1jI (I:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1v1jJ (J:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1jJ (J:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1v1jK (K:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1jK (K:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1v1jL (L:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1jL (L:)
    prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
    elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
    yvsqradgvvagcgvqgyvfgveriaalag