Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) |
Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins) automatically mapped to Pfam PF01220 |
Protein automated matches [190071] (6 species) not a true protein |
Species Streptomyces coelicolor [TaxId:1902] [186791] (3 PDB entries) |
Domain d1v1je_: 1v1j E: [119822] automated match to d1d0ia_ complexed with fa3, trs |
PDB Entry: 1v1j (more details), 2.2 Å
SCOPe Domain Sequences for d1v1je_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v1je_ c.23.13.1 (E:) automated matches {Streptomyces coelicolor [TaxId: 1902]} prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs yvsqradgvvagcgvqgyvfgveriaalag
Timeline for d1v1je_: