SCOPe 2.07: Domain d1u35d1: 1u35 D:1230-1322

Lineage for d1u35d1 (1u35 D:1230-1322)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2B [47119] (6 species)

7. Species Mouse (Mus musculus), H2Ba [TaxId:10090] [140393] (2 PDB entries)
   Uniprot Q9D2U9 34-126

8. Domain d1u35d1: 1u35 D:1230-1322 [119496]
   Other proteins in same PDB: d1u35a1, d1u35b_, d1u35c1, d1u35e1, d1u35f_, d1u35g_, d1u35h_
   protein/DNA complex

Details for d1u35d1

PDB Entry: 1u35, 3 Å

PDB Description: crystal structure of the nucleosome core particle containing the histone domain of macroh2a

PDB Compounds: (D:) Histone 3, H2ba

SCOPe Domain Sequences for d1u35d1:

Sequence; same for both SEQRES and ATOM records:

>d1u35d1 a.22.1.1 (D:1230-1322) Histone H2B {Mouse (Mus musculus), H2Ba [TaxId: 10090]}
rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiaseasrlahynkrstitsr
evqtavrlllpgelakhavsegtkavtkytssk

Timeline for d1u35d1:

• d1u35d1 first appeared in SCOP 1.73
  
• d1u35d1 appears in SCOPe 2.06
  
• d1u35d1 appears in the current release, SCOPe 2.08