| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H2B [47119] (6 species) |
| Species Mouse (Mus musculus), H2Ba [TaxId:10090] [140393] (2 PDB entries) Uniprot Q9D2U9 34-126 |
| Domain d1u35d1: 1u35 D:1230-1322 [119496] Other proteins in same PDB: d1u35a1, d1u35b_, d1u35c1, d1u35e1, d1u35f_, d1u35g_, d1u35h_ protein/DNA complex |
PDB Entry: 1u35 (more details), 3 Å
SCOPe Domain Sequences for d1u35d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u35d1 a.22.1.1 (D:1230-1322) Histone H2B {Mouse (Mus musculus), H2Ba [TaxId: 10090]}
rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiaseasrlahynkrstitsr
evqtavrlllpgelakhavsegtkavtkytssk
Timeline for d1u35d1: