Lineage for d1u35d1 (1u35 D:1230-1322)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637441Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 637442Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 637443Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 637506Protein Histone H2B [47119] (5 species)
  7. 637572Species Mouse (Mus musculus), H2Ba [TaxId:10090] [140393] (2 PDB entries)
  8. 637573Domain d1u35d1: 1u35 D:1230-1322 [119496]
    Other proteins in same PDB: d1u35a1, d1u35b1, d1u35c1, d1u35e1, d1u35f1, d1u35g1

Details for d1u35d1

PDB Entry: 1u35 (more details), 3 Å

PDB Description: crystal structure of the nucleosome core particle containing the histone domain of macroh2a
PDB Compounds: (D:) Histone 3, H2ba

SCOP Domain Sequences for d1u35d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u35d1 a.22.1.1 (D:1230-1322) Histone H2B {Mouse (Mus musculus), H2Ba [TaxId: 10090]}
rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiaseasrlahynkrstitsr
evqtavrlllpgelakhavsegtkavtkytssk

SCOP Domain Coordinates for d1u35d1:

Click to download the PDB-style file with coordinates for d1u35d1.
(The format of our PDB-style files is described here.)

Timeline for d1u35d1: