![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein macro-H2A.1, histone domain [140396] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140397] (2 PDB entries) Uniprot O75367 11-116 |
![]() | Domain d1u35c1: 1u35 C:814-919 [119495] Other proteins in same PDB: d1u35a1, d1u35b_, d1u35d1, d1u35e1, d1u35f_, d1u35g_, d1u35h_ protein/DNA complex |
PDB Entry: 1u35 (more details), 3 Å
SCOPe Domain Sequences for d1u35c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} ktsrsakagvifpvgrmlryikkghpkyrigvgapvymaavleyltaeilelavnaardn kkgrvtprhillavandeelnqllkgvtiasggvlpnihpellakk
Timeline for d1u35c1: