![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein automated matches [193445] (8 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [193446] (77 PDB entries) |
![]() | Domain d1u35g_: 1u35 G: [119499] Other proteins in same PDB: d1u35a1, d1u35c1, d1u35d1, d1u35e1 automated match to d1u35c1 protein/DNA complex |
PDB Entry: 1u35 (more details), 3 Å
SCOPe Domain Sequences for d1u35g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u35g_ a.22.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ktsrsakagvifpvgrmlryikkghpkyrigvgapvymaavleyltaeilelavnaardn kkgrvtprhillavandeelnqllkgvtiasggvlpnihpellakk
Timeline for d1u35g_: