Lineage for d1u35g_ (1u35 G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311421Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2312022Protein automated matches [193445] (8 species)
    not a true protein
  7. 2312123Species Human (Homo sapiens) [TaxId:9606] [193446] (77 PDB entries)
  8. 2312275Domain d1u35g_: 1u35 G: [119499]
    Other proteins in same PDB: d1u35a1, d1u35c1, d1u35d1, d1u35e1
    automated match to d1u35c1
    protein/DNA complex

Details for d1u35g_

PDB Entry: 1u35 (more details), 3 Å

PDB Description: crystal structure of the nucleosome core particle containing the histone domain of macroh2a
PDB Compounds: (G:) H2A histone family

SCOPe Domain Sequences for d1u35g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u35g_ a.22.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ktsrsakagvifpvgrmlryikkghpkyrigvgapvymaavleyltaeilelavnaardn
kkgrvtprhillavandeelnqllkgvtiasggvlpnihpellakk

SCOPe Domain Coordinates for d1u35g_:

Click to download the PDB-style file with coordinates for d1u35g_.
(The format of our PDB-style files is described here.)

Timeline for d1u35g_: