Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
Protein Cadmium efflux system accessory protein CadC [140239] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [140240] (1 PDB entry) Uniprot P20047 12-119 |
Domain d1u2wc_: 1u2w C: [119489] automated match to d1u2wa1 complexed with zn |
PDB Entry: 1u2w (more details), 1.9 Å
SCOPe Domain Sequences for d1u2wc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u2wc_ a.4.5.5 (C:) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} vnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgvtianashh lrtlykqgvvnfrkegklalyslgdehirqimmialah
Timeline for d1u2wc_: