![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.5: ArsR-like transcriptional regulators [46801] (4 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
![]() | Protein Cadmium efflux system accessory protein CadC [140239] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [140240] (1 PDB entry) |
![]() | Domain d1u2wc1: 1u2w C:17-114 [119489] automatically matched to 1U2W A:12-119 complexed with zn; mutant |
PDB Entry: 1u2w (more details), 1.9 Å
SCOP Domain Sequences for d1u2wc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u2wc1 a.4.5.5 (C:17-114) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} vnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgvtianashh lrtlykqgvvnfrkegklalyslgdehirqimmialah
Timeline for d1u2wc1: