SCOP 1.73: Domain d1u2wc1: 1u2w C:17-114

Lineage for d1u2wc1 (1u2w C:17-114)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.5: ArsR-like transcriptional regulators [46801] (4 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Cadmium efflux system accessory protein CadC [140239] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [140240] (1 PDB entry)

8. Domain d1u2wc1: 1u2w C:17-114 [119489]
   automatically matched to 1U2W A:12-119
   complexed with zn; mutant

Details for d1u2wc1

PDB Entry: 1u2w, 1.9 Å

PDB Description: crystal structure of the staphylococcus aureus pi258 cadc

PDB Compounds: (C:) Cadmium efflux system accessory protein

SCOP Domain Sequences for d1u2wc1:

Sequence; same for both SEQRES and ATOM records:

>d1u2wc1 a.4.5.5 (C:17-114) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]}
vnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgvtianashh
lrtlykqgvvnfrkegklalyslgdehirqimmialah

Timeline for d1u2wc1:

• d1u2wc1 is new in SCOP 1.73
  
• d1u2wc1 appears in SCOP 1.75
  
• d1u2wc1 appears in the current release, SCOPe 2.08, called d1u2wc_