SCOPe 2.08: Domain d1u17b_: 1u17 B:

Lineage for d1u17b_ (1u17 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Nitrophorin 1 [50841] (1 species)

7. Species Rhodnius prolixus [TaxId:13249] [50842] (6 PDB entries)

8. Domain d1u17b_: 1u17 B: [119416]
   automated match to d1np1a_
   complexed with hem, imd, po4; mutant

Details for d1u17b_

PDB Entry: 1u17, 1.7 Å

PDB Description: 1.7 A Crystal structure of H60C mutant of Nitrophorin I. Heme complexed with two molecules imidazole

PDB Compounds: (B:) nitrophorin 1

SCOPe Domain Sequences for d1u17b_:

Sequence; same for both SEQRES and ATOM records:

>d1u17b_ b.60.1.1 (B:) Nitrophorin 1 {Rhodnius prolixus [TaxId: 13249]}
mkctknalaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyc
ydpktqdtfydvselqeespgkytanfkkvekngnvkvdvtsgnyytftvmyaddssali
htclhkgnkdlgdlyavlnrnkdtnagdkvkgavtaaslkfsdfistkdnkceydnvslk
slltk

Timeline for d1u17b_:

• d1u17b_ first appeared in SCOP 1.73, called d1u17b1
  
• d1u17b_ appears in SCOPe 2.07