![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
![]() | Protein Nitrophorin 1 [50841] (1 species) |
![]() | Species Rhodnius prolixus [TaxId:13249] [50842] (6 PDB entries) |
![]() | Domain d1u17b_: 1u17 B: [119416] automated match to d1np1a_ complexed with hem, imd, po4; mutant |
PDB Entry: 1u17 (more details), 1.7 Å
SCOPe Domain Sequences for d1u17b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u17b_ b.60.1.1 (B:) Nitrophorin 1 {Rhodnius prolixus [TaxId: 13249]} mkctknalaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyc ydpktqdtfydvselqeespgkytanfkkvekngnvkvdvtsgnyytftvmyaddssali htclhkgnkdlgdlyavlnrnkdtnagdkvkgavtaaslkfsdfistkdnkceydnvslk slltk
Timeline for d1u17b_: