SCOP 1.73: Domain d1u17b1: 1u17 B:2-185

Lineage for d1u17b1 (1u17 B:2-185)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (8 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (20 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Nitrophorin 1 [50841] (1 species)

7. Species Rhodnius prolixus [TaxId:13249] [50842] (6 PDB entries)

8. Domain d1u17b1: 1u17 B:2-185 [119416]
   automatically matched to 1U17 A:2-185
   complexed with hem, imd, po4; mutant

Details for d1u17b1

PDB Entry: 1u17, 1.7 Å

PDB Description: 1.7 A Crystal structure of H60C mutant of Nitrophorin I. Heme complexed with two molecules imidazole

PDB Compounds: (B:) nitrophorin 1

SCOP Domain Sequences for d1u17b1:

Sequence; same for both SEQRES and ATOM records:

>d1u17b1 b.60.1.1 (B:2-185) Nitrophorin 1 {Rhodnius prolixus [TaxId: 13249]}
kctknalaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealycy
dpktqdtfydvselqeespgkytanfkkvekngnvkvdvtsgnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdtnagdkvkgavtaaslkfsdfistkdnkceydnvslks
lltk

Timeline for d1u17b1:

• d1u17b1 is new in SCOP 1.73
  
• d1u17b1 appears in SCOP 1.75
  
• d1u17b1 appears in the current release, SCOPe 2.08, called d1u17b_