Lineage for d1np1a_ (1np1 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804587Protein Nitrophorin 1 [50841] (1 species)
  7. 2804588Species Rhodnius prolixus [TaxId:13249] [50842] (6 PDB entries)
  8. 2804593Domain d1np1a_: 1np1 A: [27155]
    complexed with hem, hsm, po4

Details for d1np1a_

PDB Entry: 1np1 (more details), 2 Å

PDB Description: crystal structure of the complex of nitrophorin 1 from rhodnius prolixus with histamine
PDB Compounds: (A:) nitrophorin 1

SCOPe Domain Sequences for d1np1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1np1a_ b.60.1.1 (A:) Nitrophorin 1 {Rhodnius prolixus [TaxId: 13249]}
kctknalaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqeespgkytanfkkvekngnvkvdvtsgnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdtnagdkvkgavtaaslkfsdfistkdnkceydnvslks
lltk

SCOPe Domain Coordinates for d1np1a_:

Click to download the PDB-style file with coordinates for d1np1a_.
(The format of our PDB-style files is described here.)

Timeline for d1np1a_: