| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
| Family d.110.3.1: PYP-like [55786] (3 proteins) |
| Protein Photoactive yellow protein, PYP [55787] (1 species) |
| Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [55788] (84 PDB entries) Uniprot P16113 |
| Domain d1ts7a_: 1ts7 A: [119332] automated match to d1nwza_ complexed with hc4 |
PDB Entry: 1ts7 (more details), 1.6 Å
SCOPe Domain Sequences for d1ts7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ts7a_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv
Timeline for d1ts7a_: