PDB entry 1ts7

View 1ts7 on RCSB PDB site
Description: Structure of the pR cis wobble and pR E46Q intermediates from time-resolved Laue crystallography
Class: photoreceptor
Keywords: photoreceptor
Deposited on 2004-06-21, released 2005-07-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Photoactive yellow protein
    Species: HALORHODOSPIRA HALOPHILA [TaxId:1053]
    Gene: PYP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ts7a_
  • Heterogens: HC4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ts7A (A:)
    mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
    nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
    fvkrv