Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.65: MukF N-terminal domain-like [140289] (1 protein) N-terminal part of Pfam PF03882 |
Protein Chromosome partition protein MukF (KicB), N-terminal domain [140290] (1 species) |
Species Escherichia coli [TaxId:562] [140291] (1 PDB entry) Uniprot P60293 8-118 |
Domain d1t98b1: 1t98 B:5-118 [119198] Other proteins in same PDB: d1t98a2, d1t98b2 automated match to d1t98a1 |
PDB Entry: 1t98 (more details), 2.9 Å
SCOPe Domain Sequences for d1t98b1:
Sequence, based on SEQRES records: (download)
>d1t98b1 a.4.5.65 (B:5-118) Chromosome partition protein MukF (KicB), N-terminal domain {Escherichia coli [TaxId: 562]} sqtvpelvawarkndfsislpvdrlsfllavatlngerldgemsegelvdafrhvsdafe qtsetigvrannaindmvrqrllnrftseqaegnaiyrltplgigitdyyirqr
>d1t98b1 a.4.5.65 (B:5-118) Chromosome partition protein MukF (KicB), N-terminal domain {Escherichia coli [TaxId: 562]} sqtvpelvawarkndfsislpvdrlsfllavatlngerldgemsegelvdafrhvsdafe qtsetigvrannaindmvrqrllnrftiyrltplgigitdyyirqr
Timeline for d1t98b1: