SCOP 1.73: Domain d1t98b1: 1t98 B:8-118

Lineage for d1t98b1 (1t98 B:8-118)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.65: MukF N-terminal domain-like [140289] (1 protein)
   N-terminal part of Pfam PF03882

6. Protein Chromosome partition protein MukF (KicB), N-terminal domain [140290] (1 species)

7. Species Escherichia coli [TaxId:562] [140291] (1 PDB entry)

8. Domain d1t98b1: 1t98 B:8-118 [119198]
   Other proteins in same PDB: d1t98a2, d1t98b2
   automatically matched to 1T98 A:8-118

Details for d1t98b1

PDB Entry: 1t98, 2.9 Å

PDB Description: crystal structure of mukf(1-287)

PDB Compounds: (B:) Chromosome partition protein mukF

SCOP Domain Sequences for d1t98b1:

Sequence, based on SEQRES records:

>d1t98b1 a.4.5.65 (B:8-118) Chromosome partition protein MukF (KicB), N-terminal domain {Escherichia coli [TaxId: 562]}
vpelvawarkndfsislpvdrlsfllavatlngerldgemsegelvdafrhvsdafeqts
etigvrannaindmvrqrllnrftseqaegnaiyrltplgigitdyyirqr

Sequence, based on observed residues (ATOM records):

>d1t98b1 a.4.5.65 (B:8-118) Chromosome partition protein MukF (KicB), N-terminal domain {Escherichia coli [TaxId: 562]}
vpelvawarkndfsislpvdrlsfllavatlngerldgemsegelvdafrhvsdafeqts
etigvrannaindmvrqrllnrftiyrltplgigitdyyirqr

Timeline for d1t98b1:

• d1t98b1 is new in SCOP 1.73
  
• d1t98b1 appears in SCOP 1.75
  
• d1t98b1 appears in the current release, SCOPe 2.08