Lineage for d1t98a1 (1t98 A:8-118)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694355Family a.4.5.65: MukF N-terminal domain-like [140289] (1 protein)
    N-terminal part of Pfam PF03882
  6. 2694356Protein Chromosome partition protein MukF (KicB), N-terminal domain [140290] (1 species)
  7. 2694357Species Escherichia coli [TaxId:562] [140291] (1 PDB entry)
    Uniprot P60293 8-118
  8. 2694358Domain d1t98a1: 1t98 A:8-118 [119196]
    Other proteins in same PDB: d1t98a2, d1t98b2

Details for d1t98a1

PDB Entry: 1t98 (more details), 2.9 Å

PDB Description: crystal structure of mukf(1-287)
PDB Compounds: (A:) Chromosome partition protein mukF

SCOPe Domain Sequences for d1t98a1:

Sequence, based on SEQRES records: (download)

>d1t98a1 a.4.5.65 (A:8-118) Chromosome partition protein MukF (KicB), N-terminal domain {Escherichia coli [TaxId: 562]}
vpelvawarkndfsislpvdrlsfllavatlngerldgemsegelvdafrhvsdafeqts
etigvrannaindmvrqrllnrftseqaegnaiyrltplgigitdyyirqr

Sequence, based on observed residues (ATOM records): (download)

>d1t98a1 a.4.5.65 (A:8-118) Chromosome partition protein MukF (KicB), N-terminal domain {Escherichia coli [TaxId: 562]}
vpelvawarkndfsislpvdrlsfllavatlngerldgemsegelvdafrhvsdafeqts
etigvrannaindmvrqrllnrftiyrltplgigitdyyirqr

SCOPe Domain Coordinates for d1t98a1:

Click to download the PDB-style file with coordinates for d1t98a1.
(The format of our PDB-style files is described here.)

Timeline for d1t98a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t98a2