| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
| Family d.109.1.2: Cofilin-like [55762] (8 proteins) |
| Protein automated matches [190045] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186766] (6 PDB entries) |
| Domain d1t3ya_: 1t3y A: [119141] automated match to d1wnja_ |
PDB Entry: 1t3y (more details), 1.15 Å
SCOPe Domain Sequences for d1t3ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t3ya_ d.109.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvrlfaf
vrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdrkele
edfikselkka
Timeline for d1t3ya_: