PDB entry 1t3y

View 1t3y on RCSB PDB site
Description: Three Crystal Structures of Human Coactosin-like Protein
Class: protein binding
Keywords: Beta sheet, PROTEIN BINDING
Deposited on 2004-04-28, released 2005-08-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.119
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coactosin-like protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1t3ya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t3yA (A:)
    atkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvrlfaf
    vrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdrkele
    edfikselkkagganydaqte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3yA (A:)
    atkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvrlfaf
    vrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdrkele
    edfikselkka