Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.2: Cofilin-like [55762] (8 proteins) |
Protein Coactosin-like protein Cotl1 (Clp) [111105] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [111107] (2 PDB entries) Uniprot Q14019 |
Domain d1wnja_: 1wnj A: [109436] |
PDB Entry: 1wnj (more details)
SCOPe Domain Sequences for d1wnja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wnja_ d.109.1.2 (A:) Coactosin-like protein Cotl1 (Clp) {Human (Homo sapiens) [TaxId: 9606]} girmatkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvr lfafvrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdr keleedfikselkkagganydaqte
Timeline for d1wnja_: