Lineage for d1wnja_ (1wnj A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1922095Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1922096Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 1922229Family d.109.1.2: Cofilin-like [55762] (8 proteins)
  6. 1922234Protein Coactosin-like protein Cotl1 (Clp) [111105] (2 species)
  7. 1922235Species Human (Homo sapiens) [TaxId:9606] [111107] (2 PDB entries)
    Uniprot Q14019
  8. 1922238Domain d1wnja_: 1wnj A: [109436]

Details for d1wnja_

PDB Entry: 1wnj (more details)

PDB Description: nmr structure of human coactosin-like protein
PDB Compounds: (A:) Coactosin-like protein

SCOPe Domain Sequences for d1wnja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wnja_ d.109.1.2 (A:) Coactosin-like protein Cotl1 (Clp) {Human (Homo sapiens) [TaxId: 9606]}
girmatkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvr
lfafvrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdr
keleedfikselkkagganydaqte

SCOPe Domain Coordinates for d1wnja_:

Click to download the PDB-style file with coordinates for d1wnja_.
(The format of our PDB-style files is described here.)

Timeline for d1wnja_: