Lineage for d1t3ya_ (1t3y A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1922095Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1922096Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 1922229Family d.109.1.2: Cofilin-like [55762] (8 proteins)
  6. 1922281Protein automated matches [190045] (5 species)
    not a true protein
  7. 1922291Species Human (Homo sapiens) [TaxId:9606] [186766] (6 PDB entries)
  8. 1922292Domain d1t3ya_: 1t3y A: [119141]
    automated match to d1wnja_

Details for d1t3ya_

PDB Entry: 1t3y (more details), 1.15 Å

PDB Description: Three Crystal Structures of Human Coactosin-like Protein
PDB Compounds: (A:) Coactosin-like protein

SCOPe Domain Sequences for d1t3ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3ya_ d.109.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvrlfaf
vrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdrkele
edfikselkka

SCOPe Domain Coordinates for d1t3ya_:

Click to download the PDB-style file with coordinates for d1t3ya_.
(The format of our PDB-style files is described here.)

Timeline for d1t3ya_: