| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.8: spliceosomal protein U5-15Kd [52895] (2 proteins) automatically mapped to Pfam PF02966 |
| Protein spliceosomal protein U5-15Kd [52896] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52897] (3 PDB entries) |
| Domain d1syxe_: 1syx E: [119084] Other proteins in same PDB: d1syxb_, d1syxd_, d1syxf_ automated match to d1qgva_ |
PDB Entry: 1syx (more details), 2.35 Å
SCOPe Domain Sequences for d1syxe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1syxe_ c.47.1.8 (E:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]}
ymlphlhngwqvdqailseedrvvvirfghdwdptcmkmdevlysiaekvknfaviylvd
itevpdfnkmyelydpctvmfffrnkhimidlgtgnnnkinwamedkqemvdiietvyrg
arkgrglvvspkdys
Timeline for d1syxe_: