Lineage for d1syxe_ (1syx E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877383Family c.47.1.8: spliceosomal protein U5-15Kd [52895] (2 proteins)
    automatically mapped to Pfam PF02966
  6. 2877384Protein spliceosomal protein U5-15Kd [52896] (1 species)
  7. 2877385Species Human (Homo sapiens) [TaxId:9606] [52897] (3 PDB entries)
  8. 2877389Domain d1syxe_: 1syx E: [119084]
    Other proteins in same PDB: d1syxb_, d1syxd_, d1syxf_
    automated match to d1qgva_

Details for d1syxe_

PDB Entry: 1syx (more details), 2.35 Å

PDB Description: the crystal structure of a binary u5 snrnp complex
PDB Compounds: (E:) Spliceosomal U5 snRNP-specific 15 kDa protein

SCOPe Domain Sequences for d1syxe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1syxe_ c.47.1.8 (E:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]}
ymlphlhngwqvdqailseedrvvvirfghdwdptcmkmdevlysiaekvknfaviylvd
itevpdfnkmyelydpctvmfffrnkhimidlgtgnnnkinwamedkqemvdiietvyrg
arkgrglvvspkdys

SCOPe Domain Coordinates for d1syxe_:

Click to download the PDB-style file with coordinates for d1syxe_.
(The format of our PDB-style files is described here.)

Timeline for d1syxe_: