Lineage for d1syxb_ (1syx B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2524880Fold d.76: GYF/BRK domain-like [55276] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2524881Superfamily d.76.1: GYF domain [55277] (1 family) (S)
  5. 2524882Family d.76.1.1: GYF domain [55278] (3 proteins)
    Pfam PF02213
  6. 2524883Protein GYF domain from cd2bp2 protein [55279] (1 species)
  7. 2524884Species Human (Homo sapiens) [TaxId:9606] [55280] (3 PDB entries)
  8. 2524885Domain d1syxb_: 1syx B: [119081]
    Other proteins in same PDB: d1syxa_, d1syxc_, d1syxe_
    automated match to d1syxb1

Details for d1syxb_

PDB Entry: 1syx (more details), 2.35 Å

PDB Description: The crystal structure of a binary U5 snRNP complex
PDB Compounds: (B:) CD2 antigen cytoplasmic tail-binding protein 2

SCOPe Domain Sequences for d1syxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1syxb_ d.76.1.1 (B:) GYF domain from cd2bp2 protein {Human (Homo sapiens) [TaxId: 9606]}
dvmweykwentgdaelygpftsaqmqtwvsegyfpdgvycrkldppggqfynskridfdl
yt

SCOPe Domain Coordinates for d1syxb_:

Click to download the PDB-style file with coordinates for d1syxb_.
(The format of our PDB-style files is described here.)

Timeline for d1syxb_: