Lineage for d1syxf_ (1syx F:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2524880Fold d.76: GYF/BRK domain-like [55276] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2524881Superfamily d.76.1: GYF domain [55277] (1 family) (S)
  5. 2524882Family d.76.1.1: GYF domain [55278] (3 proteins)
    Pfam PF02213
  6. 2524883Protein GYF domain from cd2bp2 protein [55279] (1 species)
  7. 2524884Species Human (Homo sapiens) [TaxId:9606] [55280] (3 PDB entries)
  8. 2524887Domain d1syxf_: 1syx F: [119085]
    Other proteins in same PDB: d1syxa_, d1syxc_, d1syxe_
    automated match to d1syxf1

Details for d1syxf_

PDB Entry: 1syx (more details), 2.35 Å

PDB Description: the crystal structure of a binary u5 snrnp complex
PDB Compounds: (F:) CD2 antigen cytoplasmic tail-binding protein 2

SCOPe Domain Sequences for d1syxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1syxf_ d.76.1.1 (F:) GYF domain from cd2bp2 protein {Human (Homo sapiens) [TaxId: 9606]}
dvmweykwentgdaelygpftsaqmqtwvsegyfpdgvycrkldppggqfynskridfdl
yt

SCOPe Domain Coordinates for d1syxf_:

Click to download the PDB-style file with coordinates for d1syxf_.
(The format of our PDB-style files is described here.)

Timeline for d1syxf_: