SCOP 1.73: Domain d1syxb1: 1syx B:25-86

Lineage for d1syxb1 (1syx B:25-86)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.76: GYF domain [55276] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.76.1: GYF domain [55277] (1 family)

5. Family d.76.1.1: GYF domain [55278] (2 proteins)
   Pfam PF02213

6. Protein GYF domain from cd2bp2 protein [55279] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55280] (3 PDB entries)

8. Domain d1syxb1: 1syx B:25-86 [119081]
   Other proteins in same PDB: d1syxa1, d1syxc1, d1syxe1
   automatically matched to d1gyfa_

Details for d1syxb1

PDB Entry: 1syx, 2.35 Å

PDB Description: the crystal structure of a binary u5 snrnp complex

PDB Compounds: (B:) CD2 antigen cytoplasmic tail-binding protein 2

SCOP Domain Sequences for d1syxb1:

Sequence; same for both SEQRES and ATOM records:

>d1syxb1 d.76.1.1 (B:25-86) GYF domain from cd2bp2 protein {Human (Homo sapiens) [TaxId: 9606]}
dvmweykwentgdaelygpftsaqmqtwvsegyfpdgvycrkldppggqfynskridfdl
yt

Timeline for d1syxb1:

• d1syxb1 is new in SCOP 1.73
  
• d1syxb1 appears in SCOP 1.75
  
• d1syxb1 appears in the current release, SCOPe 2.08, called d1syxb_