Lineage for d1syxd_ (1syx D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958413Fold d.76: GYF/BRK domain-like [55276] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958414Superfamily d.76.1: GYF domain [55277] (1 family) (S)
  5. 2958415Family d.76.1.1: GYF domain [55278] (3 proteins)
    Pfam PF02213
  6. 2958416Protein GYF domain from cd2bp2 protein [55279] (1 species)
  7. 2958417Species Human (Homo sapiens) [TaxId:9606] [55280] (3 PDB entries)
  8. 2958419Domain d1syxd_: 1syx D: [119083]
    Other proteins in same PDB: d1syxa_, d1syxc_, d1syxe_
    automated match to d1syxd1

Details for d1syxd_

PDB Entry: 1syx (more details), 2.35 Å

PDB Description: the crystal structure of a binary u5 snrnp complex
PDB Compounds: (D:) CD2 antigen cytoplasmic tail-binding protein 2

SCOPe Domain Sequences for d1syxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1syxd_ d.76.1.1 (D:) GYF domain from cd2bp2 protein {Human (Homo sapiens) [TaxId: 9606]}
dvmweykwentgdaelygpftsaqmqtwvsegyfpdgvycrkldppggqfynskridfdl
yt

SCOPe Domain Coordinates for d1syxd_:

Click to download the PDB-style file with coordinates for d1syxd_.
(The format of our PDB-style files is described here.)

Timeline for d1syxd_: