Lineage for d1syxe1 (1syx E:3-137)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699772Family c.47.1.8: spliceosomal protein U5-15Kd [52895] (1 protein)
  6. 699773Protein spliceosomal protein U5-15Kd [52896] (1 species)
  7. 699774Species Human (Homo sapiens) [TaxId:9606] [52897] (3 PDB entries)
  8. 699778Domain d1syxe1: 1syx E:3-137 [119084]
    Other proteins in same PDB: d1syxb1, d1syxd1, d1syxf1
    automatically matched to d1qgva_

Details for d1syxe1

PDB Entry: 1syx (more details), 2.35 Å

PDB Description: the crystal structure of a binary u5 snrnp complex
PDB Compounds: (E:) Spliceosomal U5 snRNP-specific 15 kDa protein

SCOP Domain Sequences for d1syxe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1syxe1 c.47.1.8 (E:3-137) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]}
ymlphlhngwqvdqailseedrvvvirfghdwdptcmkmdevlysiaekvknfaviylvd
itevpdfnkmyelydpctvmfffrnkhimidlgtgnnnkinwamedkqemvdiietvyrg
arkgrglvvspkdys

SCOP Domain Coordinates for d1syxe1:

Click to download the PDB-style file with coordinates for d1syxe1.
(The format of our PDB-style files is described here.)

Timeline for d1syxe1: