SCOPe 2.08: Domain d1sl9a_: 1sl9 A:

Lineage for d1sl9a_ (1sl9 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calcium-regulated photoprotein [47512] (4 species)
   structurally most similar to sarcoplasmic calcium-binding protein

7. Species Hydrozoa (Obelia longissima), obelin [TaxId:32570] [63541] (8 PDB entries)
   Uniprot Q27709

8. Domain d1sl9a_: 1sl9 A: [118971]
   automated match to d1el4a_
   complexed with czh
   has additional insertions and/or extensions that are not grouped together

Details for d1sl9a_

PDB Entry: 1sl9, 1.17 Å

PDB Description: obelin from obelia longissima

PDB Compounds: (A:) obelin

SCOPe Domain Sequences for d1sl9a_:

Sequence, based on SEQRES records:

>d1sl9a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]}
yavklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrh
qvcveaffrgcgmeygkeiafpqfldgwkqlatselkkwarneptlirewgdavfdifdk
dgsgtitldewkaygkisgispsqedceatfrhcdldnagdldvdemtrqhlgfwytldp
eadglygngvp

Sequence, based on observed residues (ATOM records):

>d1sl9a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]}
yavklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrh
qvcveaffrgcgmeygkeiafpqfldgwkqlatselkkwarneptlirewgdavfdifgt
itldewkaygkisgispsqedceatfrhcdldnagdldvdemtrqhlgfwytldpeadgl
ygngvp

Timeline for d1sl9a_:

• d1sl9a_ first appeared in SCOP 1.73, called d1sl9a1
  
• d1sl9a_ appears in SCOPe 2.07