PDB entry 1sl9

View 1sl9 on RCSB PDB site
Description: Obelin from Obelia longissima
Class: luminescent protein
Keywords: Photoprotein, obelin, bioluminescence, atomic resolution, calcium binding, EF-hand, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, LUMINESCENT PROTEIN
Deposited on 2004-03-05, released 2005-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: 0.157
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: obelin
    Species: Obelia longissima [TaxId:32570]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27709 (Start-194)
      • engineered (162)
    Domains in SCOPe 2.07: d1sl9a_
  • Heterogens: CZH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sl9A (A:)
    msskyavklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeq
    tkrhqvcveaffrgcgmeygkeiafpqfldgwkqlatselkkwarneptlirewgdavfd
    ifdkdgsgtitldewkaygkisgispsqedceatfrhcdldnagdldvdemtrqhlgfwy
    tldpeadglygngvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sl9A (A:)
    yavklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrh
    qvcveaffrgcgmeygkeiafpqfldgwkqlatselkkwarneptlirewgdavfdifgt
    itldewkaygkisgispsqedceatfrhcdldnagdldvdemtrqhlgfwytldpeadgl
    ygngvp