Lineage for d1ndad2 (1nda D:4-169,D:287-357)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2850224Protein Trypanothione reductase, N- and C-terminal domain [418954] (3 species)
  7. 2850243Species Trypanosoma cruzi [TaxId:5693] [419414] (4 PDB entries)
  8. 2850253Domain d1ndad2: 1nda D:4-169,D:287-357 [118568]
    Other proteins in same PDB: d1ndaa2, d1ndaa3, d1ndab2, d1ndab3, d1ndac1, d1ndac3, d1ndad1, d1ndad3
    duplicate of 1NDA A:4-169,A:287-357
    complexed with fad
    has additional insertions and/or extensions that are not grouped together

Details for d1ndad2

PDB Entry: 1nda (more details), 3.3 Å

PDB Description: the structure of trypanosoma cruzi trypanothione reductase in the oxidized and nadph reduced state
PDB Compounds: (D:) trypanothione oxidoreductase

SCOPe Domain Sequences for d1ndad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndad2 c.3.1.5 (D:4-169,D:287-357) Trypanothione reductase, N- and C-terminal domain {Trypanosoma cruzi [TaxId: 5693]}
ifdlvvigagsggleaawnaatlykkrvavidvqmvhgppffsalggtcvnvgcvpkklm
vtgaqymehlresagfgwefdrttlraewkkliavkdeavlninksyeemfrdtegleff
lgwgslesknvvnvresadpasavkerletenillasgswphmpniXrsprtkdlqlqna
gvmiknggvqvdeysrtnvsniyaigdvtnrvmltpvaineaaalvdtvfgtnprktd

SCOPe Domain Coordinates for d1ndad2:

Click to download the PDB-style file with coordinates for d1ndad2.
(The format of our PDB-style files is described here.)

Timeline for d1ndad2: