Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) |
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
Protein Trypanothione reductase, middle domain [418955] (3 species) |
Domain d1ndac1: 1nda C:170-286 [118564] Other proteins in same PDB: d1ndaa1, d1ndaa3, d1ndab1, d1ndab3, d1ndac2, d1ndac3, d1ndad2, d1ndad3 duplicate of 1NDA A:170-286 complexed with fad |
PDB Entry: 1nda (more details), 3.3 Å
SCOPe Domain Sequences for d1ndac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ndac1 c.3.1.5 (C:170-286) Trypanothione reductase, middle domain {Trypanosoma cruzi [TaxId: 5693]} pgiehcissneafylpepprrvltvgggfisvefagifnaykpkdgqvtlcyrgemilrg fdhtlreeltkqltangiqiltkenpakvelnadgsksvtfesgkkmdfdlvmmaig
Timeline for d1ndac1: