Lineage for d1ndac1 (1nda C:170-286)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2850194Protein Trypanothione reductase, middle domain [418955] (3 species)
  7. Species Trypanosoma cruzi [TaxId:5693] [419415] (4 PDB entries)
  8. 2850222Domain d1ndac1: 1nda C:170-286 [118564]
    Other proteins in same PDB: d1ndaa1, d1ndaa3, d1ndab1, d1ndab3, d1ndac2, d1ndac3, d1ndad2, d1ndad3
    duplicate of 1NDA A:170-286
    complexed with fad

Details for d1ndac1

PDB Entry: 1nda (more details), 3.3 Å

PDB Description: the structure of trypanosoma cruzi trypanothione reductase in the oxidized and nadph reduced state
PDB Compounds: (C:) trypanothione oxidoreductase

SCOPe Domain Sequences for d1ndac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndac1 c.3.1.5 (C:170-286) Trypanothione reductase, middle domain {Trypanosoma cruzi [TaxId: 5693]}
pgiehcissneafylpepprrvltvgggfisvefagifnaykpkdgqvtlcyrgemilrg
fdhtlreeltkqltangiqiltkenpakvelnadgsksvtfesgkkmdfdlvmmaig

SCOPe Domain Coordinates for d1ndac1:

Click to download the PDB-style file with coordinates for d1ndac1.
(The format of our PDB-style files is described here.)

Timeline for d1ndac1: