SCOPe 2.08: Domain d1ndad3: 1nda D:358-484

Lineage for d1ndad3 (1nda D:358-484)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)
   both first two domains are of same beta/beta/alpha fold

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)

6. Protein Trypanothione reductase [55429] (3 species)

7. Species Trypanosoma cruzi [TaxId:5693] [55431] (4 PDB entries)

8. Domain d1ndad3: 1nda D:358-484 [118569]
   Other proteins in same PDB: d1ndaa1, d1ndaa2, d1ndab1, d1ndab2, d1ndac1, d1ndac2, d1ndad1, d1ndad2
   duplicate of 1NDA A:358-484
   complexed with fad

Details for d1ndad3

PDB Entry: 1nda, 3.3 Å

PDB Description: the structure of trypanosoma cruzi trypanothione reductase in the oxidized and nadph reduced state

PDB Compounds: (D:) trypanothione oxidoreductase

SCOPe Domain Sequences for d1ndad3:

Sequence; same for both SEQRES and ATOM records:

>d1ndad3 d.87.1.1 (D:358-484) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]}
htrvasavfsippigtcglieevaskryevvavylssftplmhnisgskyktfvakiitn
hsdgtvlgvhllgdnapeiiqgvgiclklnakisdfyntigvhptsaeelcsmrtpsyyy
vkgekme

Timeline for d1ndad3:

• d1ndad3 first appeared in SCOP 1.73
  
• d1ndad3 appears in SCOPe 2.07