Lineage for d1ndad3 (1nda D:358-484)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528291Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2528292Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2528293Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2528424Protein Trypanothione reductase [55429] (3 species)
  7. 2528443Species Trypanosoma cruzi [TaxId:5693] [55431] (4 PDB entries)
  8. 2528453Domain d1ndad3: 1nda D:358-484 [118569]
    Other proteins in same PDB: d1ndaa1, d1ndaa2, d1ndab1, d1ndab2, d1ndac1, d1ndac2, d1ndad1, d1ndad2
    duplicate of 1NDA A:358-484
    complexed with fad

Details for d1ndad3

PDB Entry: 1nda (more details), 3.3 Å

PDB Description: the structure of trypanosoma cruzi trypanothione reductase in the oxidized and nadph reduced state
PDB Compounds: (D:) trypanothione oxidoreductase

SCOPe Domain Sequences for d1ndad3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndad3 d.87.1.1 (D:358-484) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]}
htrvasavfsippigtcglieevaskryevvavylssftplmhnisgskyktfvakiitn
hsdgtvlgvhllgdnapeiiqgvgiclklnakisdfyntigvhptsaeelcsmrtpsyyy
vkgekme

SCOPe Domain Coordinates for d1ndad3:

Click to download the PDB-style file with coordinates for d1ndad3.
(The format of our PDB-style files is described here.)

Timeline for d1ndad3: