![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
![]() | Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) ![]() both first two domains are of same beta/beta/alpha fold |
![]() | Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins) |
![]() | Protein Trypanothione reductase [55429] (3 species) |
![]() | Species Trypanosoma cruzi [TaxId:5693] [55431] (4 PDB entries) |
![]() | Domain d1ndac3: 1nda C:358-484 [118566] Other proteins in same PDB: d1ndaa1, d1ndaa2, d1ndab1, d1ndab2, d1ndac1, d1ndac2, d1ndad1, d1ndad2 duplicate of 1NDA A:358-484 complexed with fad |
PDB Entry: 1nda (more details), 3.3 Å
SCOPe Domain Sequences for d1ndac3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ndac3 d.87.1.1 (C:358-484) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} htrvasavfsippigtcglieevaskryevvavylssftplmhnisgskyktfvakiitn hsdgtvlgvhllgdnapeiiqgvgiclklnakisdfyntigvhptsaeelcsmrtpsyyy vkgekme
Timeline for d1ndac3: