Lineage for d1ndac3 (1nda C:358-484)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962835Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2962836Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2962837Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2962968Protein Trypanothione reductase [55429] (3 species)
  7. 2962987Species Trypanosoma cruzi [TaxId:5693] [55431] (4 PDB entries)
  8. 2962996Domain d1ndac3: 1nda C:358-484 [118566]
    Other proteins in same PDB: d1ndaa1, d1ndaa2, d1ndab1, d1ndab2, d1ndac1, d1ndac2, d1ndad1, d1ndad2
    duplicate of 1NDA A:358-484
    complexed with fad

Details for d1ndac3

PDB Entry: 1nda (more details), 3.3 Å

PDB Description: the structure of trypanosoma cruzi trypanothione reductase in the oxidized and nadph reduced state
PDB Compounds: (C:) trypanothione oxidoreductase

SCOPe Domain Sequences for d1ndac3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndac3 d.87.1.1 (C:358-484) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]}
htrvasavfsippigtcglieevaskryevvavylssftplmhnisgskyktfvakiitn
hsdgtvlgvhllgdnapeiiqgvgiclklnakisdfyntigvhptsaeelcsmrtpsyyy
vkgekme

SCOPe Domain Coordinates for d1ndac3:

Click to download the PDB-style file with coordinates for d1ndac3.
(The format of our PDB-style files is described here.)

Timeline for d1ndac3: