Class b: All beta proteins [48724] (177 folds) |
Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily) beta-sandwich: 8 strands in 2 sheets |
Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family) |
Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (3 proteins) |
Protein DnaK [100922] (3 species) |
Species Escherichia coli [TaxId:562] [100923] (7 PDB entries) |
Domain d1bpra1: 1bpr A:382-506 [118433] Other proteins in same PDB: d1bpra2 trimmed to exclude a fragment of another domain, used as a covalent linker to the bound peptide |
PDB Entry: 1bpr (more details)
SCOPe Domain Sequences for d1bpra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bpra1 b.130.1.1 (A:382-506) DnaK {Escherichia coli [TaxId: 562]} iegrvkdvllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihvl qgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkiti kassg
Timeline for d1bpra1: