PDB entry 1bpr

View 1bpr on RCSB PDB site
Description: nmr structure of the substrate binding domain of dnak, minimized average structure
Class: molecular chaperone
Keywords: molecular chaperone, hsp70, peptide binding, protein folding
Deposited on 1998-08-11, released 1999-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dnak
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6Y8
      • conflict (10-12)
      • conflict (14)
    Domains in SCOPe 2.06: d1bpra1, d1bpra2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bprA (A:)
    rgshhhhhhgsiegrvkdvllldvtplslgietmggvmttliaknttiptkhsqvfstae
    dnqsavtihvlqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakd
    knsgkeqkitikassglnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqv
    eeagdklpadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bprA (A:)
    siegrvkdvllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihv
    lqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkit
    ikassglnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveea