Lineage for d1bpra1 (1bpr A:381-506)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1814264Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily)
    beta-sandwich: 8 strands in 2 sheets
  4. 1814265Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family) (S)
  5. 1814266Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (3 proteins)
  6. 1814270Protein DnaK [100922] (3 species)
  7. 1814274Species Escherichia coli [TaxId:562] [100923] (7 PDB entries)
  8. 1814280Domain d1bpra1: 1bpr A:381-506 [118433]
    trimmed to exclude a fragment of another domain, used as a covalent linker to the bound peptide

Details for d1bpra1

PDB Entry: 1bpr (more details)

PDB Description: nmr structure of the substrate binding domain of dnak, minimized average structure
PDB Compounds: (A:) dnak

SCOPe Domain Sequences for d1bpra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bpra1 b.130.1.1 (A:381-506) DnaK {Escherichia coli [TaxId: 562]}
siegrvkdvllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihv
lqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkit
ikassg

SCOPe Domain Coordinates for d1bpra1:

Click to download the PDB-style file with coordinates for d1bpra1.
(The format of our PDB-style files is described here.)

Timeline for d1bpra1: