SCOPe 2.08: Domain d1bpra1: 1bpr A:382-506

Lineage for d1bpra1 (1bpr A:382-506)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily)
   beta-sandwich: 8 strands in 2 sheets

4. Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family)

5. Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (3 proteins)

6. Protein DnaK [100922] (3 species)

7. Species Escherichia coli [TaxId:562] [100923] (7 PDB entries)

8. Domain d1bpra1: 1bpr A:382-506 [118433]
   Other proteins in same PDB: d1bpra2
   trimmed to exclude a fragment of another domain, used as a covalent linker to the bound peptide

Details for d1bpra1

PDB Entry: 1bpr

PDB Description: nmr structure of the substrate binding domain of dnak, minimized average structure

PDB Compounds: (A:) dnak

SCOPe Domain Sequences for d1bpra1:

Sequence; same for both SEQRES and ATOM records:

>d1bpra1 b.130.1.1 (A:382-506) DnaK {Escherichia coli [TaxId: 562]}
iegrvkdvllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihvl
qgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkiti
kassg

Timeline for d1bpra1:

• d1bpra1 first appeared in SCOP 1.73
  
• d1bpra1 appears in SCOPe 2.07