![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
![]() | Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (4 families) ![]() |
![]() | Family d.41.2.2: Monomeric nicotinate phosphoribosyltransferase N-terminal domain-like [110907] (1 protein) |
![]() | Protein Nicotinate phosphoribosyltransferase, N-terminal domain [110908] (4 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [117887] (1 PDB entry) Uniprot Q8UIS9 |
![]() | Domain d1ybea2: 1ybe A:8-167 [116606] Other proteins in same PDB: d1ybea1, d1ybeb1 Structural genomics target |
PDB Entry: 1ybe (more details), 2.5 Å
SCOPe Domain Sequences for d1ybea2:
Sequence, based on SEQRES records: (download)
>d1ybea2 d.41.2.2 (A:8-167) Nicotinate phosphoribosyltransferase, N-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} mtktdiatrvhnhtwkldpivrslidtdfykllmlqmiwklypevdatfslinrtktvrl aeeidemelreqldhartlrlskkeniwlagntfygrsqifepeflswlssyqlpeyelf krdgqyelnfhgrwmdttlweipalsiinelrsrsamrsl
>d1ybea2 d.41.2.2 (A:8-167) Nicotinate phosphoribosyltransferase, N-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} mtktdiatrwkldpivrslidtdfykllmlqmiwklypevdatfslinrtktvrlaeeid emelreqldhartlrlskkeniwlagntfygrsqifepeflswlssyqlpeyelfkrdgq yelnfhgrwmdttlweipalsiinelrsrsamrsl
Timeline for d1ybea2: