PDB entry 1ybe

View 1ybe on RCSB PDB site
Description: Crystal Structure of a Nicotinate phosphoribosyltransferase
Class: transferase
Keywords: Structural genomics, Protein structure initiative, NYSGXRC, T1764, PSI, New York SGX Research Center for Structural Genomics, TRANSFERASE
Deposited on 2004-12-20, released 2005-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-30, with a file datestamp of 2014-04-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nicotinate phosphoribosyltransferase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene: pncB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ybea1, d1ybea2
  • Chain 'B':
    Compound: Nicotinate phosphoribosyltransferase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene: pncB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ybeb1, d1ybeb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ybeA (A:)
    mslgnasmtktdiatrvhnhtwkldpivrslidtdfykllmlqmiwklypevdatfslin
    rtktvrlaeeidemelreqldhartlrlskkeniwlagntfygrsqifepeflswlssyq
    lpeyelfkrdgqyelnfhgrwmdttlweipalsiinelrsrsamrslgyftldvlyarak
    akmwekverlrelpglrisdfgtrrrhsflwqrwcvealkegigpaftgtsnvllamdsd
    leavgtnahelpmvvaalaqtneelaaapyqvlkdwnrlyggnllivlpdafgtaaflrn
    apewvadwtgfrpdsappieggekiiewwrkmgrdprtkmlifsdgldvdaivdtyrhfe
    grvrmsfgwgtnltndfagcapktiaslkpisivckvsdangrpavklsdnpqkatgdpa
    everylkffgeedhkeqkvlveghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybeA (A:)
    mtktdiatrwkldpivrslidtdfykllmlqmiwklypevdatfslinrtktvrlaeeid
    emelreqldhartlrlskkeniwlagntfygrsqifepeflswlssyqlpeyelfkrdgq
    yelnfhgrwmdttlweipalsiinelrsrsamrslgyftldvlyarakakmwekverlre
    lpglrisdfgtrrrhsflwqrwcvealkegigpaftgtsnvllamdsdleavgtnahelp
    mvvaalaqtneelaaapyqvlkdwnrlyggnllivlpdafgtaaflrnapewvadwtgfr
    pdsappieggekiiewwrkmgrdprtkmlifsdgldvdaivdtyrhfegrvrmsfgwgtn
    ltndfagcaplkpisivckvsdangrpavklsdnpqkatgdpaeverylkffgeed
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ybeB (B:)
    mslgnasmtktdiatrvhnhtwkldpivrslidtdfykllmlqmiwklypevdatfslin
    rtktvrlaeeidemelreqldhartlrlskkeniwlagntfygrsqifepeflswlssyq
    lpeyelfkrdgqyelnfhgrwmdttlweipalsiinelrsrsamrslgyftldvlyarak
    akmwekverlrelpglrisdfgtrrrhsflwqrwcvealkegigpaftgtsnvllamdsd
    leavgtnahelpmvvaalaqtneelaaapyqvlkdwnrlyggnllivlpdafgtaaflrn
    apewvadwtgfrpdsappieggekiiewwrkmgrdprtkmlifsdgldvdaivdtyrhfe
    grvrmsfgwgtnltndfagcapktiaslkpisivckvsdangrpavklsdnpqkatgdpa
    everylkffgeedhkeqkvlveghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybeB (B:)
    mtktdiatrwkldpivrslidtdfykllmlqmiwklypevdatfslinrtktvrlaeeid
    emelreqldhartlrlskkeniwlagntfygrsqifepeflswlssyqlpeyelfkrdgq
    yelnfhgrwmdttlweipalsiinelrsrsamrslgyftldvlyarakakmwekverlre
    lpglrisdfgtrrrhsflwqrwcvealkegigpaftgtsnvllamdsdleavgtnahelp
    mvvaalaqtneelaaapyqvlkdwnrlyggnllivlpdafgtaaflrnapewvadwtgfr
    pdsappieggekiiewwrkmgrdprtkmlifsdgldvdaivdtyrhfegrvrmsfgwgtn
    ltndfagcaplkpisivckvsdangrpavklsdnpqkatgdpaeverylkffgeed