Lineage for d1ybea2 (1ybe A:8-167)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602004Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 602061Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (2 families) (S)
  5. 602095Family d.41.2.2: Monomeric nicotinate phosphoribosyltransferase N-terminal domain-like [110907] (1 protein)
  6. 602096Protein Nicotinate phosphoribosyltransferase, N-terminal domain [110908] (2 species)
  7. 602097Species Agrobacterium tumefaciens [TaxId:358] [117887] (1 PDB entry)
  8. 602098Domain d1ybea2: 1ybe A:8-167 [116606]
    Other proteins in same PDB: d1ybea1, d1ybeb1

Details for d1ybea2

PDB Entry: 1ybe (more details), 2.5 Å

PDB Description: crystal structure of a nicotinate phosphoribosyltransferase

SCOP Domain Sequences for d1ybea2:

Sequence, based on SEQRES records: (download)

>d1ybea2 d.41.2.2 (A:8-167) Nicotinate phosphoribosyltransferase, N-terminal domain {Agrobacterium tumefaciens}
mtktdiatrvhnhtwkldpivrslidtdfykllmlqmiwklypevdatfslinrtktvrl
aeeidemelreqldhartlrlskkeniwlagntfygrsqifepeflswlssyqlpeyelf
krdgqyelnfhgrwmdttlweipalsiinelrsrsamrsl

Sequence, based on observed residues (ATOM records): (download)

>d1ybea2 d.41.2.2 (A:8-167) Nicotinate phosphoribosyltransferase, N-terminal domain {Agrobacterium tumefaciens}
mtktdiatrwkldpivrslidtdfykllmlqmiwklypevdatfslinrtktvrlaeeid
emelreqldhartlrlskkeniwlagntfygrsqifepeflswlssyqlpeyelfkrdgq
yelnfhgrwmdttlweipalsiinelrsrsamrsl

SCOP Domain Coordinates for d1ybea2:

Click to download the PDB-style file with coordinates for d1ybea2.
(The format of our PDB-style files is described here.)

Timeline for d1ybea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ybea1