SCOPe 2.08: Domain d1ybeb2: 1ybe B:8-167

Lineage for d1ybeb2 (1ybe B:8-167)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (4 families)

5. Family d.41.2.2: Monomeric nicotinate phosphoribosyltransferase N-terminal domain-like [110907] (1 protein)

6. Protein Nicotinate phosphoribosyltransferase, N-terminal domain [110908] (4 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [117887] (1 PDB entry)
   Uniprot Q8UIS9

8. Domain d1ybeb2: 1ybe B:8-167 [116608]
   Other proteins in same PDB: d1ybea1, d1ybeb1
   Structural genomics target

Details for d1ybeb2

PDB Entry: 1ybe, 2.5 Å

PDB Description: crystal structure of a nicotinate phosphoribosyltransferase

PDB Compounds: (B:) Nicotinate phosphoribosyltransferase

SCOPe Domain Sequences for d1ybeb2:

Sequence, based on SEQRES records:

>d1ybeb2 d.41.2.2 (B:8-167) Nicotinate phosphoribosyltransferase, N-terminal domain {Agrobacterium tumefaciens [TaxId: 358]}
mtktdiatrvhnhtwkldpivrslidtdfykllmlqmiwklypevdatfslinrtktvrl
aeeidemelreqldhartlrlskkeniwlagntfygrsqifepeflswlssyqlpeyelf
krdgqyelnfhgrwmdttlweipalsiinelrsrsamrsl

Sequence, based on observed residues (ATOM records):

>d1ybeb2 d.41.2.2 (B:8-167) Nicotinate phosphoribosyltransferase, N-terminal domain {Agrobacterium tumefaciens [TaxId: 358]}
mtktdiatrwkldpivrslidtdfykllmlqmiwklypevdatfslinrtktvrlaeeid
emelreqldhartlrlskkeniwlagntfygrsqifepeflswlssyqlpeyelfkrdgq
yelnfhgrwmdttlweipalsiinelrsrsamrsl

Timeline for d1ybeb2:

• d1ybeb2 first appeared in SCOP 1.71
  
• d1ybeb2 appears in SCOPe 2.07