Lineage for d1ybeb1 (1ybe B:168-433)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089241Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 2089293Family c.1.17.2: Monomeric nicotinate phosphoribosyltransferase C-terminal domain [110910] (1 protein)
    automatically mapped to Pfam PF04095
  6. 2089294Protein Nicotinate phosphoribosyltransferase, C-terminal domain [110911] (4 species)
  7. 2089295Species Agrobacterium tumefaciens [TaxId:358] [117391] (1 PDB entry)
    Uniprot Q8UIS9
  8. 2089297Domain d1ybeb1: 1ybe B:168-433 [116607]
    Other proteins in same PDB: d1ybea2, d1ybeb2
    Structural genomics target

Details for d1ybeb1

PDB Entry: 1ybe (more details), 2.5 Å

PDB Description: Crystal Structure of a Nicotinate phosphoribosyltransferase
PDB Compounds: (B:) Nicotinate phosphoribosyltransferase

SCOPe Domain Sequences for d1ybeb1:

Sequence, based on SEQRES records: (download)

>d1ybeb1 c.1.17.2 (B:168-433) Nicotinate phosphoribosyltransferase, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]}
gyftldvlyarakakmwekverlrelpglrisdfgtrrrhsflwqrwcvealkegigpaf
tgtsnvllamdsdleavgtnahelpmvvaalaqtneelaaapyqvlkdwnrlyggnlliv
lpdafgtaaflrnapewvadwtgfrpdsappieggekiiewwrkmgrdprtkmlifsdgl
dvdaivdtyrhfegrvrmsfgwgtnltndfagcapktiaslkpisivckvsdangrpavk
lsdnpqkatgdpaeverylkffgeed

Sequence, based on observed residues (ATOM records): (download)

>d1ybeb1 c.1.17.2 (B:168-433) Nicotinate phosphoribosyltransferase, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]}
gyftldvlyarakakmwekverlrelpglrisdfgtrrrhsflwqrwcvealkegigpaf
tgtsnvllamdsdleavgtnahelpmvvaalaqtneelaaapyqvlkdwnrlyggnlliv
lpdafgtaaflrnapewvadwtgfrpdsappieggekiiewwrkmgrdprtkmlifsdgl
dvdaivdtyrhfegrvrmsfgwgtnltndfagcaplkpisivckvsdangrpavklsdnp
qkatgdpaeverylkffgeed

SCOPe Domain Coordinates for d1ybeb1:

Click to download the PDB-style file with coordinates for d1ybeb1.
(The format of our PDB-style files is described here.)

Timeline for d1ybeb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ybeb2